FLJ22167 (N-Term) anticorps

N° du produit ABIN630360

Cet anticorps anti- est un anticorps Lapin Polyclonal détectant dans WB et IHC. Adapté pour Humain et Chien.

Aperçu rapide pour FLJ22167 (N-Term) anticorps (ABIN630360)

Antigène: FLJ22167

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit

Épitope: N-Term

Specificité: FLJ22167 antibody was raised against the N terminal of FLJ22167

Purification: Purified

Immunogène: FLJ22167 antibody was raised using the N terminal of FLJ22167 corresponding to a region with amino acids CHEAPRARSARAGLPNRLPTALFNSGFWLKRSSYEEQPTVRFQHQVLLVA

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FLJ22167 Blocking Peptide, (ABIN937093), is also available for use as a blocking control in assays to test for specificity of this FLJ22167 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ22167 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: FLJ22167

Sujet: The FLJ22167 protein catalyzes the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues and O-linked sugars of mucin-type acceptors. FLJ22167 acts on the non-reducing terminal GlcNAc of short carbohydrate substrates.

Poids moléculaire: 36 kDa (MW of target protein)